| Basic Information | |
|---|---|
| Taxon OID | 3300012964 Open in IMG/M |
| Scaffold ID | Ga0153916_10247803 Open in IMG/M |
| Source Dataset Name | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1797 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio, Lake Erie, Old Woman Creek | |||||||
| Coordinates | Lat. (o) | 41.3778 | Long. (o) | -82.5108 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006925 | Metagenome | 362 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153916_102478035 | F006925 | AGG | MVADVSVLKDFGREAANRRKWMRMWQTLGERILKMPKWMQNIVLEDVNTALRNRIAVMEMIQNAKRNH* |
| ⦗Top⦘ |