Scaffold Ga0164299_11204766

Overview

Basic Information

• Taxon OID: 3300012958
• Scaffold ID: Ga0164299_11204766
• Source Dataset Name: Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 573
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Mt. Pleasant research farm, Cornell University, New York
• Coordinates
  • Lat. (^o): 42.4531
  • Long. (^o): -76.3842
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065044	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164299_112047661	F065044	N/A	EKNVNKFRYLEIWHEYCAVNYVDKQSICRISAYLLPIRKGKYRMNRLIATGLAISAIALIAPKTADAASLVIDDASLEGSIIFSVGQFDFGMGFVLDGTQILAPSLGTASATVSEGTAATGPITHSFSGQFITGGALVAPTSGTIALPEAGGGISDILTFNYTGGGAEVGGVATLTGSFVSDLDPGGSLV