| Basic Information | |
|---|---|
| Taxon OID | 3300012956 Open in IMG/M |
| Scaffold ID | Ga0154020_11050301 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 624 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Austria: Klosterneuburg | |||||||
| Coordinates | Lat. (o) | 48.3 | Long. (o) | 16.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061835 | Metagenome / Metatranscriptome | 131 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0154020_110503011 | F061835 | N/A | KEGKKVALYTHDDLDGIFSACEVKKYLLNSGFTIVKYGILNYSEGWKYTTLDPKLINVVLDFANMPGDERDDMIDYYLDHHGIFTPEELEKYKSSPVQKKKTGSAYEAICQSLGVPQDSLTLDVIDMIDSAKYQDYGVDWQRLLDFNLSDIKKSDKKRLEFGAAFNQFLKRSDSKTIISVIENCPDASIYSIFNVMKKVYPEHNVVM |
| ⦗Top⦘ |