Scaffold Ga0163111_10217158

Overview

Basic Information

• Taxon OID: 3300012954
• Scaffold ID: Ga0163111_10217158
• Source Dataset Name: Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1660
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location

• Location Name: Costa Rica: the Eastern Pacific
• Coordinates
  • Lat. (^o): 0.8736
  • Long. (^o): -97.0511
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058282	Metagenome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163111_102171581	F058282	AGGAGG	MAYDSSLPAGGPGNFVSPNTAHEADGVEVDFITVDYISDVSGEVTEPRASANTAALQLAMEAIQNQGVNILGKGVLSNSDTEQTYMVRRDSLDTISGTTTVAAIQAAIRAL