Basic Information | |
---|---|
Taxon OID | 3300012953 Open in IMG/M |
Scaffold ID | Ga0163179_11967686 Open in IMG/M |
Source Dataset Name | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 537 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 34.876 | Long. (o) | -13.1352 | Alt. (m) | Depth (m) | 80 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016739 | Metagenome / Metatranscriptome | 245 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0163179_119676862 | F016739 | N/A | MRLNGGLLSSETSEWVKLRQAWKKWNASCHPDDQIDWDEFLEEHS* |
⦗Top⦘ |