Basic Information | |
---|---|
Taxon OID | 3300012953 Open in IMG/M |
Scaffold ID | Ga0163179_10090963 Open in IMG/M |
Source Dataset Name | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2186 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 34.876 | Long. (o) | -13.1352 | Alt. (m) | Depth (m) | 80 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004325 | Metagenome / Metatranscriptome | 443 | Y |
F027869 | Metagenome | 193 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0163179_100909632 | F004325 | N/A | MKKKKKASTNEKADQFLAGLGTAGGAIGSPQLVGFGASDVQNQIVSGNTDEYANIRMRQEEIKIGESAAMPPDLDASYLKLNLPGSPLPSNGLLAPRNIVAAEQTQDMLLSQEQMFLAQYLPAAGLSRLPVGQPPLESGKGDK* |
Ga0163179_100909633 | F027869 | AGG | MDTKKAQKAVRMAEMAMDLMDLEDEMAEAQEADLQPEDGYINPMGRIGTVPPSTYSLGNMLNGTTTQSVINPET* |
⦗Top⦘ |