Scaffold Ga0163179_10000235

Overview

Basic Information

• Taxon OID: 3300012953
• Scaffold ID: Ga0163179_10000235
• Source Dataset Name: Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 39334
• Total Scaffold Genes: 49
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (38.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean
• Coordinates
  • Lat. (^o): 34.876
  • Long. (^o): -13.1352
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007227	Metagenome / Metatranscriptome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163179_1000023546	F007227	N/A	MWLLNPHDHHFLYQKDDGTFYGFTHIKGEDPEEWFWQAHGLQLELFPPEPPKKIEVGKDAPHHNILEKYYGKDWKPTPQQGLEDHF*