Basic Information | |
---|---|
Taxon OID | 3300012952 Open in IMG/M |
Scaffold ID | Ga0163180_11734560 Open in IMG/M |
Source Dataset Name | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 529 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 26.049 | Long. (o) | -17.4585 | Alt. (m) | Depth (m) | 80 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044192 | Metagenome | 155 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0163180_117345601 | F044192 | AGGA | MYIDKYEIVSWGRKWNKGKESKKAEIIKSCYNEDHGMGGKKFLQLLSDLDDAWHEHEGKDCVVHVSFEDPKERE* |
⦗Top⦘ |