NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163108_10402992

Scaffold Ga0163108_10402992


Overview

Basic Information
Taxon OID3300012950 Open in IMG/M
Scaffold IDGa0163108_10402992 Open in IMG/M
Source Dataset NameMarine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)882
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location NameThe Central Pacific Ocean
CoordinatesLat. (o)10.0Long. (o)-145.0Alt. (m)Depth (m)155
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049047Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
Ga0163108_104029921F049047AGGMPDYPSLNEEHFKEVMLDTNDFIKEQLSSTPFHVNLGLTFIGFIFLCLILTIKSVQIFKKEKHSDGSIILSVIALNKYLSSFARVYRSLTVLAFYEHPKVIKIIDS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.