Scaffold Ga0163108_10286386

Overview

Basic Information

• Taxon OID: 3300012950
• Scaffold ID: Ga0163108_10286386
• Source Dataset Name: Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1060
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location

• Location Name: The Central Pacific Ocean
• Coordinates
  • Lat. (^o): 10.0
  • Long. (^o): -145.0
  • Depth (m): 155

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051113	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163108_102863861	F051113	N/A	DRKGLLMAGADRAIRELMFIFKDDPIEIPLEEATMSVWARMQLEE*