NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153798_10242437

Scaffold Ga0153798_10242437


Overview

Basic Information
Taxon OID3300012949 Open in IMG/M
Scaffold IDGa0153798_10242437 Open in IMG/M
Source Dataset NameSwitchgrass enrichment cultures co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)613
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location
Location NameUSA: Dartmouth College, New Hampshire
CoordinatesLat. (o)43.726Long. (o)-72.1429Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026178Metagenome / Metatranscriptome198Y

Sequences

Protein IDFamilyRBSSequence
Ga0153798_102424371F026178N/AKSSCHDVLFEFFTTNTPDQHHSTQNSGFGVFLSVWVHLEPFCYCTKIAAKRAKLVQLMQKFVP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.