NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0162652_100011137

Scaffold Ga0162652_100011137


Overview

Basic Information
Taxon OID3300012941 Open in IMG/M
Scaffold IDGa0162652_100011137 Open in IMG/M
Source Dataset NameAgricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1119
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameRanch near Red Deer, Alberta, Canada
CoordinatesLat. (o)52.172047Long. (o)-113.738964Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020506Metagenome223Y
F024778Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0162652_1000111371F024778GGAGGVNRPDSRNAAGGWQATPGQPIPRAARQPAANGLLLVMLLLVWFSPLSIVAWLLGQVAILLQRRWHWWRFTLASLITIGVVLAVTGPAQALRRHVFVPQHFWQYVALHFGYGPPGTRVTVGQFLWDLVITQVWLAVPVGLLAASLSVWNAERAAGGAEWSPFVRRRQRIDQRTRDRRTARLLAKPRDHKLTAPALGVALDGDLRSWRQGRYVV
Ga0162652_1000111372F020506N/ARLVGLDVRAWSFVIPQLAHVHAVGVVRLALEPSIPAGGRWLSERELRREAGKSHVPDAAIQLPDDQDLAAGAGLYGEDVDPLPKRIAVEVELTRKGAARLREAWTRPRHGRWPRTSYYAPPEVAGYLTGQLARIRPRHPIQVHPLPDVPGTSYLRPGGAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.