| Basic Information | |
|---|---|
| Taxon OID | 3300012940 Open in IMG/M |
| Scaffold ID | Ga0164243_10048109 Open in IMG/M |
| Source Dataset Name | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4888 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Emeryville, California | |||||||
| Coordinates | Lat. (o) | 37.83 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025247 | Metagenome / Metatranscriptome | 202 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164243_100481093 | F025247 | N/A | MNQDPLHLAEHDVTWLAIRQPAVLRLLERELGSARVFRDGDAFCAGRALACELLGARSQVGAPRLDHHVLAAGLASVRAGRCDRAMVRSIRDQIDELPVALTPAEQDAVATVIAAVIWAVLDTSVRALDDMLVA* |
| ⦗Top⦘ |