Scaffold Ga0162650_100015763

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0162650_100015763

Scaffold Ga0162650_100015763

Overview

Basic Information
Taxon OID	3300012939 Open in IMG/M
Scaffold ID	Ga0162650_100015763 Open in IMG/M
Source Dataset Name	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1039
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location Name	Ranch near Red Deer, Alberta, Canada
Coordinates	Lat. (^o)	52.172047	Long. (^o)	-113.738964	Alt. (m)		Depth (m)	.15
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006916	Metagenome / Metatranscriptome	362	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0162650_1000157631	F006916	AGAAGG	MKPRVSAQLHSSSGRSSKILKDHTHIGTVVEVAGVGRLELDVTSGGCYSLRAYPEGSEEPSRDLLAVGVVHADEIIAINPEGLSAVDGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.