Scaffold Ga0162651_100044185

Overview

Basic Information

• Taxon OID: 3300012938
• Scaffold ID: Ga0162651_100044185
• Source Dataset Name: Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 688
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: Ranch near Red Deer, Alberta, Canada
• Coordinates
  • Lat. (^o): 52.172047
  • Long. (^o): -113.738964

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029211	Metagenome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0162651_1000441853	F029211	AGAAG	MRAALLIVALVLPNIALALPDDATLSRLLVGTWHGHRHDTEYRADGAWIMDPPDEGDNSRGKWRIEHG