Basic Information | |
---|---|
Taxon OID | 3300012936 Open in IMG/M |
Scaffold ID | Ga0163109_11119514 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 574 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Costa Rica: the Eastern Pacific | |||||||
Coordinates | Lat. (o) | 9.5025 | Long. (o) | -92.3286 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004907 | Metagenome / Metatranscriptome | 419 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0163109_111195142 | F004907 | N/A | DIANSELWSLNDWPEDQGFQSSDRAHYIRRIIETTDFDRKFLQAEQELITINRLTECPKNDTVRAYMKMNEKLAEGMVQ* |
⦗Top⦘ |