Scaffold Ga0163109_10967808

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163109_10967808

Scaffold Ga0163109_10967808

Overview

Basic Information
Taxon OID	3300012936 Open in IMG/M
Scaffold ID	Ga0163109_10967808 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	622
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location Name	Costa Rica: the Eastern Pacific
Coordinates	Lat. (^o)	9.5025	Long. (^o)	-92.3286	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053978	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163109_109678081	F053978	GGAGG	MHINDTTKQMIREIVVELFKEVASKQTFGVSDEVLQLDEHLHDWTGRKIDKYKVEVYGARLQERY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.