Scaffold Ga0157211_1001326

Overview

Basic Information

• Taxon OID: 3300012933
• Scaffold ID: Ga0157211_1001326
• Source Dataset Name: Freshwater microbial communities from Tributary to Mariposa, Ontario, Canada - S7
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3698
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location

• Location Name: Kawartha Lakes, Ontario
• Coordinates
  • Lat. (^o): 44.33257
  • Long. (^o): -78.9405

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052550	Metagenome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157211_10013267	F052550	AGG	MRSGFWQLQHSINLIHKTMITTINNDLRVYQVIDSLGRNYFCNIEELNRVINDNQLRAGYFKIYHFWNNKPRRVSKKDLLSFFEGAEKTQEFIY*