NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153915_12733389

Scaffold Ga0153915_12733389


Overview

Basic Information
Taxon OID3300012931 Open in IMG/M
Scaffold IDGa0153915_12733389 Open in IMG/M
Source Dataset NameFreshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)577
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie, Old Woman Creek
CoordinatesLat. (o)41.3778Long. (o)-82.5108Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024925Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0153915_127333891F024925N/ALMNSQRSLIESIFKELGYEIQATAFQNLLSFKLKPLEKPVLEPVPRKKLMEALIYEMSASSCDEAFSKIKEPIDEMFPEDYPWTIREVGERLIDMYRELDVEVEIEYFEGGFTLKYKTCPYYELVKSGQKTWLCGLRKRVIDYTLSRVSHGKKGKIKIIKSLLKNEHPCEYAVFLTGFLEED*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.