Scaffold Ga0160423_10379309

Overview

Basic Information

• Taxon OID: 3300012920
• Scaffold ID: Ga0160423_10379309
• Source Dataset Name: Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 968
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Lipsvirus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location

• Location Name: Costa Rica: the Eastern Pacific
• Coordinates
  • Lat. (^o): 8.7051
  • Long. (^o): -86.4906
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059056	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160423_103793093	F059056	AGGAG	MTGLELFIVIGGCYAIYTVGMAIATSIDYYSTNKEEQLIKRRK*