NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0160423_10068257

Scaffold Ga0160423_10068257


Overview

Basic Information
Taxon OID3300012920 Open in IMG/M
Scaffold IDGa0160423_10068257 Open in IMG/M
Source Dataset NameMarine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2548
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location
Location NameCosta Rica: the Eastern Pacific
CoordinatesLat. (o)8.7051Long. (o)-86.4906Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005707Metagenome / Metatranscriptome392Y

Sequences

Protein IDFamilyRBSSequence
Ga0160423_100682573F005707GGAGMAQTFIVKGDVVTNPSANDFSRAVFVRIVATNDVTGTLFESDGSTEVGKFYLENGMSIIIEKHPSEKITCATSKAHAVGSPKS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.