Basic Information | |
---|---|
Taxon OID | 3300012920 Open in IMG/M |
Scaffold ID | Ga0160423_10056415 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2842 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Costa Rica: the Eastern Pacific | |||||||
Coordinates | Lat. (o) | 8.7051 | Long. (o) | -86.4906 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007584 | Metagenome / Metatranscriptome | 348 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0160423_100564153 | F007584 | AGGAG | MNKAEIVGRLLMVLIGFAVAMLGIIYAVHTQDVYLGILISVGGVASVLGGLPQ* |
⦗Top⦘ |