Scaffold Ga0160428_1002089

Overview

Basic Information

• Taxon OID: 3300012890
• Scaffold ID: Ga0160428_1002089
• Source Dataset Name: Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12983
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (69.23%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface → Solar Panel Surface Microbial Communities From Lawrence Berkeley National Laboratory, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Building 30, Lawrence Berkeley National Lab, Berkeley, California
• Coordinates
  • Lat. (^o): 37.876387
  • Long. (^o): -122.246777

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104247	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160428_10020892	F104247	GGAG	MQLCILKRMPSTPFPLRLYPTESAARKAVLALADFRGERLTVVLYALLPADDKKPTYLLSSSIRLTVPEKRWVEAHRATVVKLGTFYPRRNFKPTWFGDISQSHRSE*