Scaffold Ga0126335_1048519

Overview

Basic Information

• Taxon OID: 3300012887
• Scaffold ID: Ga0126335_1048519
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2461
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Hawaii
• Coordinates
  • Lat. (^o): 21.4686
  • Long. (^o): -157.8184
  • Depth (m): 8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062424	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126335_10485191	F062424	AGG	MLRFPGLESPGKRHRSWKTLEKSWNSKVVVLEILLSGSSIAH