Scaffold Ga0160425_1007579

Overview

Basic Information

• Taxon OID: 3300012886
• Scaffold ID: Ga0160425_1007579
• Source Dataset Name: Microbial communities from bioreactor (seeded with sewage sludge) at Lawrence Berkeley National Lab, California, USA - Biofuel Metagenome 8 (Illumina Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6070
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (44.44%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Berkeley, California
• Coordinates
  • Lat. (^o): 37.82
  • Long. (^o): -122.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089856	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160425_10075793	F089856	AGGA	MTAIRFLAPLFAAATLTGCINVMNNRPTGVSSIPCTYRFKALSRPEDQSRVEAAIHSVAVGSVVKAGTVSYPEYRFRVARMADLDRLHPQLLFNNPQAFIPSTLRQSLNLRGGGVDMTFDSTDVSASATLTLTFAVKPGSRLYYKNPGGYESDITARVDKKGRVVLPVTVKEGQRYLYARAMKDNVVRYIRINIFTNHVEDIPKHQY*