| Basic Information | |
|---|---|
| Taxon OID | 3300012831 Open in IMG/M |
| Scaffold ID | Ga0160459_109891 Open in IMG/M |
| Source Dataset Name | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1151 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Madison, Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.073 | Long. (o) | -89.4011 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020217 | Metagenome / Metatranscriptome | 225 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0160459_1098912 | F020217 | GGAG | MKAQFETSVPGEAGITSQIREFFRRYGANFVDLTIGKRSDVDALLEFYGAPLRFIGSTFHRVMNDSAAITGADGMGGEIDRLRRAGFAGSTLDKCQISVLNSRAALVDALWLRRDGAGALMARFGVIYLMTLTTSGWRITSAVNTSE* |
| ⦗Top⦘ |