| Basic Information | |
|---|---|
| Taxon OID | 3300012782 Open in IMG/M |
| Scaffold ID | Ga0138268_1634435 Open in IMG/M |
| Source Dataset Name | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 639 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica | |||||||
| Coordinates | Lat. (o) | -64.7711 | Long. (o) | -64.056 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038049 | Metagenome / Metatranscriptome | 166 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138268_16344351 | F038049 | AGAAG | MATNQLDGVREGADAAKPKISQAGTDGGWTHVTPLKARYASPTGIMSFDGESAWTQYDPHMLVPKEWGKQAENWCNSLRDWPDPAGGMWATGNKASWKSVNYRRWPLHRVPKYDRSGIEVDL* |
| ⦗Top⦘ |