| Basic Information | |
|---|---|
| Taxon OID | 3300012774 Open in IMG/M |
| Scaffold ID | Ga0138283_1266045 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 601 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Quebec | |||||||
| Coordinates | Lat. (o) | 48.2311 | Long. (o) | -71.2508 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009334 | Metagenome / Metatranscriptome | 319 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138283_12660452 | F009334 | AGGAG | MKTAKVDGQTVTIGDVVCFKSDVEQSGTIIDIKQSYSGTSLTLESKYGFHGDYIGGQEITTELA |
| ⦗Top⦘ |