NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138281_1073522

Scaffold Ga0138281_1073522


Overview

Basic Information
Taxon OID3300012755 Open in IMG/M
Scaffold IDGa0138281_1073522 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)695
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Quebec
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105256Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0138281_10735221F105256N/ASIYQRFLSQSLSKGFLDNSDTAFLTTIQNTLSMESSVCNNLIKDSKKNIISLAVEKIFASPRIDPDNVIKIRKMADQFNINLKNDLSISNEQRAKLFRIEIDSGIEKGNINNQSLDLIIKIQENYGLENVIAKKILFECVNTRCEGHLLNSIASLRRGDDVGVLKELESMLNFGELLPVKFQNNLISFNEKSQLFSILSSNFSESETQKGKLNLFKTMLDL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.