Scaffold Ga0157564_1104958

Overview

Basic Information

• Taxon OID: 3300012747
• Scaffold ID: Ga0157564_1104958
• Source Dataset Name: Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES063 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 663
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 46.041
  • Long. (^o): -89.686
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006834	Metagenome / Metatranscriptome	363	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0157564_11049581	F006834	N/A	RIDECQIANDWNDTTTYANFSLCLRGEADEWLASKVRLLELTPAQKTWTRIRPLFKKEFAACSDDKLIIDGLANLAHRPGENPRKFMSRLEKLVNTLNENYACYRIKLERPAPLQPQGTYTEDMLTAYANDSIKAYSKFLLTQIFRAAAPENVRKLLSHKDQTRLTVDDAYDTFFTDHRVETDRKERAMVNVINDAEEDSGNASAEQDIAAFRPQQRQQQ