| Basic Information | |
|---|---|
| Taxon OID | 3300012739 Open in IMG/M |
| Scaffold ID | Ga0157540_101757 Open in IMG/M |
| Source Dataset Name | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES028 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1024 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina brevifila | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 46.008 | Long. (o) | -89.701 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007463 | Metagenome / Metatranscriptome | 350 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157540_1017571 | F007463 | N/A | MSGQFTKANAGSNDTVLELHEFLTMLVRISFFRANPQYGMRLGKDQKNADKFGEEVPLPGCLSDMLTNLVLPNARHDTYAQEFAETTLPLPEVQAALGAQLEKLSQFYELVSAGRPFLELDQWLKTLEGKLLFSDIMVDGYVVRLTEPQARAAFYASAATPSSGLLPDELPVCVARTACDKYKGVTPMGPGAKVTGFLANLLGDDDEEDVVLAATGGKALKD* |
| ⦗Top⦘ |