| Basic Information | |
|---|---|
| Taxon OID | 3300012727 Open in IMG/M |
| Scaffold ID | Ga0157531_1137954 Open in IMG/M |
| Source Dataset Name | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 533 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 46.008 | Long. (o) | -89.701 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007746 | Metagenome / Metatranscriptome | 345 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157531_11379541 | F007746 | N/A | LWQDTGTSASSAGDKQINRFPRRVRIHGGEFGESARAIHRIELEKSSSSRIKEIPWFD* |
| ⦗Top⦘ |