NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157611_1118947

Scaffold Ga0157611_1118947


Overview

Basic Information
Taxon OID3300012724 Open in IMG/M
Scaffold IDGa0157611_1118947 Open in IMG/M
Source Dataset NameEutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1162
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.099Long. (o)-89.405Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015058Metagenome / Metatranscriptome257N
F085119Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0157611_11189472F015058N/AMDDSWIHTLNSDMMRKEREKLKGQGIVISNLVSKCQNKTDKEKKYVKVLEFMNSIEVLVHFAEQALIWTTRSQLIPGIRIPAEAIKTLAYNDHESLKEKLGAIAVARASILRKKGLMQFHSLSESGNNPVDLYETEKTIVLMKLEARLLQLEHLYKSLLEIKPVELKMFQ*
Ga0157611_11189473F085119N/AMNQTLLSKEDVMILDLLERVKKKENTLIEESKKQDFIREIQLENFSSEKRRFLVKLLVQNTELKLACKEEKGIANYVTEKFFQKKTLDISDEQLLQQEIFTFQQKLGRIA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.