Scaffold Ga0157604_1174966

Overview

Basic Information

• Taxon OID: 3300012723
• Scaffold ID: Ga0157604_1174966
• Source Dataset Name: Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 635
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.099
  • Long. (^o): -89.405
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100736	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157604_11749663	F100736	GGA	MDFESALRLTSRQHLPNPEELAEHLMDVLTWRQLRRLAIRNKIHQYSYLNKKGLAKMLAYQAFNRASRYPTINGLLSPQST