| Basic Information | |
|---|---|
| Taxon OID | 3300012693 Open in IMG/M |
| Scaffold ID | Ga0157573_1042948 Open in IMG/M |
| Source Dataset Name | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES075 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 551 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 46.041 | Long. (o) | -89.686 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001679 | Metagenome / Metatranscriptome | 653 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157573_10429482 | F001679 | N/A | VWRISRCQEAMKGVEDCDKPGEAVKQALIPGFLNDCMLNS* |
| ⦗Top⦘ |