Scaffold Ga0136614_10579232

Overview

Basic Information

• Taxon OID: 3300012684
• Scaffold ID: Ga0136614_10579232
• Source Dataset Name: Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 801
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctica: Dry Valley
• Coordinates
  • Lat. (^o): -78.0526
  • Long. (^o): 163.748

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079686	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136614_105792323	F079686	N/A	GRCGKCGLPPDGPGRIVLIDDGSPEEGFPDDPEERCGSCGRRLWYVLRVVYEGDDAA*