Scaffold Ga0136612_10024295

Overview

Basic Information

• Taxon OID: 3300012680
• Scaffold ID: Ga0136612_10024295
• Source Dataset Name: Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3028
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctica: Dry Valley
• Coordinates
  • Lat. (^o): -78.0456
  • Long. (^o): 164.0158

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025939	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136612_100242953	F025939	AGGA	VATLLQGAFVYDPNPSFGADPTPFVILMVAGFVVGVAGHIVRARALVAVGIGMIFLATFVLPLLVNVLRSGE*