| Basic Information | |
|---|---|
| Taxon OID | 3300012677 Open in IMG/M |
| Scaffold ID | Ga0153928_1110000 Open in IMG/M |
| Source Dataset Name | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 533 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New Jersey, Wharton State Forest | |||||||
| Coordinates | Lat. (o) | 39.7096 | Long. (o) | -74.6638 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008285 | Metagenome | 335 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153928_11100002 | F008285 | GGA | MGKANGLSRRPDWQKGVERDNEDQKLIKPEWIRGVETLMEEENLRERIRKAQEGDEKIVKAVEELKRAGIKVLKDKEWEIEDGIVLKEGRI |
| ⦗Top⦘ |