Scaffold Ga0157216_10060445

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157216_10060445

Scaffold Ga0157216_10060445

Overview

Basic Information
Taxon OID	3300012668 Open in IMG/M
Scaffold ID	Ga0157216_10060445 Open in IMG/M
Source Dataset Name	Arctic soils microbial communities. Combined Assembly of 23 SPs
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1875
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Norway: Midre Lovenbreen, Svalbard
Coordinates	Lat. (^o)	79.1005	Long. (^o)	12.15611	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005292	Metagenome / Metatranscriptome	405	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157216_100604453	F005292	AGGA	MSYELFNPATTITRKFSRQHWAKALELAGLYGWRPMGTRPPSTHNFHELGVDWDGTYLTNDGQIIKAEDALSLAIALERALDDIPDANVKMDWSPKFWIEDDLPEWLSPLEKEMIEEGLEEELQDIMGTHPFEYFAGDEKQHLTRFIRFCKLGSFIVL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.