Scaffold Ga0157216_10051785

Overview

Basic Information

• Taxon OID: 3300012668
• Scaffold ID: Ga0157216_10051785
• Source Dataset Name: Arctic soils microbial communities. Combined Assembly of 23 SPs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2044
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Norway: Midre Lovenbreen, Svalbard
• Coordinates
  • Lat. (^o): 79.1005
  • Long. (^o): 12.15611
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007858	Metagenome / Metatranscriptome	343	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157216_100517852	F007858	AGGA	MCRALIVLCVAEDADALAELKKAAVSAEWELAQGAVEMRSALDQIDTERPHVLVAFGDQAELVGLVRERFGAMRIVTDRDTPGATVVATSLDEVRGSVKGLPRPGGPVGA*