| Basic Information | |
|---|---|
| Taxon OID | 3300012668 Open in IMG/M |
| Scaffold ID | Ga0157216_10030384 Open in IMG/M |
| Source Dataset Name | Arctic soils microbial communities. Combined Assembly of 23 SPs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Bristol |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2770 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Midre Lovenbreen, Svalbard | |||||||
| Coordinates | Lat. (o) | 79.1005 | Long. (o) | 12.15611 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047664 | Metagenome / Metatranscriptome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157216_100303843 | F047664 | N/A | VNSIPKEYLMTRKTILLGFAAATMMAAPLSAGGNEQSGPTVGDCMSDGLYGNEPNVIVGTGGPAEQTPGSQAGNVVPSQSPGPWVNNPTDPENPTWGNSAGAWNQEGFNVPEICRTFTQ* |
| ⦗Top⦘ |