Basic Information | |
---|---|
Taxon OID | 3300012667 Open in IMG/M |
Scaffold ID | Ga0157208_10017491 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Molecular Research LP (MR DNA) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 967 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Keswick, Ontario | |||||||
Coordinates | Lat. (o) | 44.22385 | Long. (o) | -79.4212 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014494 | Metagenome / Metatranscriptome | 262 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157208_100174912 | F014494 | AGGA | MAVTKHFECRACEAEGKIVLKGTEHQLSDIVYCPVCSGDIYEEEEFDDEE* |
⦗Top⦘ |