| Basic Information | |
|---|---|
| Taxon OID | 3300012665 Open in IMG/M |
| Scaffold ID | Ga0157210_1001351 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7619 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Douro-Dummer, Ontario | |||||||
| Coordinates | Lat. (o) | 44.4982 | Long. (o) | -79.1546 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021237 | Metagenome / Metatranscriptome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157210_100135111 | F021237 | N/A | MRHYDYDWDLYPDKIILDEELNIDKLGWKGGDYFKLVNVNGKAQLIKVDPLVKFLKDGEKLKNE* |
| ⦗Top⦘ |