NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157210_1001327

Scaffold Ga0157210_1001327


Overview

Basic Information
Taxon OID3300012665 Open in IMG/M
Scaffold IDGa0157210_1001327 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Talbot River, Ontario, Canada - S11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7761
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (10.53%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameDouro-Dummer, Ontario
CoordinatesLat. (o)44.4982Long. (o)-79.1546Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013761Metagenome / Metatranscriptome268Y
F058139Metagenome / Metatranscriptome135N
F097347Metagenome / Metatranscriptome104N
F099310Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0157210_100132716F013761N/AMNVELIISKDRIPYLVEGLGADRVTVSEYDEEQDSVAFEVRSQLDVLYAFHAGIRYGSDSMANALLKR*
Ga0157210_100132718F099310N/AMSKLHYYKDIIISFLLTLLFGVRVEGEKINLEYGVEAPKRTTVPSDQPDQYSWFAEHRVSSLHGVRQHVFL*
Ga0157210_10013273F097347N/AMPYVDLESVNKSTVVSDLKTVIGKKITQNQSPTLVAKLVKVGKVNCVFESVESDYKETIGLVGYKVGVQYKVPTQRAWNSFFY*
Ga0157210_10013277F058139N/AMAIYNNDRDPNDIQWEKEQMEIQVLEPRRKFEQWWEQNKERILAEDQLNHDMQFKSKFIKDGDY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.