Scaffold Ga0157497_1000431

Overview

Basic Information

• Taxon OID: 3300012664
• Scaffold ID: Ga0157497_1000431
• Source Dataset Name: Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8404
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (22.22%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location

• Location Name: Pefferlaw, Ontario
• Coordinates
  • Lat. (^o): 44.25162
  • Long. (^o): -79.2626

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001483	Metagenome / Metatranscriptome	686	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157497_10004315	F001483	N/A	MDKLKDFLLSLLTYIGESPFRLFTVVFLCILGFGGWIVYTEKDAFMATYRAQQALPKMNGRYDEAYNFLLKNTDAEMVAFLEVNTLVNTRKVVYLSTRNGGRDKRNDGLEVGLFSKNYDNNQDVIGLMSGKIPCSPYLKPQSLIGFVYKEHGVNYMCRISVPAEPGVFIGQISVGWKEKPEDVEAAQTAMVIASSLLFKK*