| Basic Information | |
|---|---|
| Taxon OID | 3300012663 Open in IMG/M |
| Scaffold ID | Ga0157203_1018336 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Indian River, Ontario, Canada - S50 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1043 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → unclassified Acinetobacter → Acinetobacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Warsaw, Ontario | |||||||
| Coordinates | Lat. (o) | 44.42735 | Long. (o) | -78.1359 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010161 | Metagenome | 307 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157203_10183362 | F010161 | GAGG | MTRKNKMLYDALIDYVSYFYNCSDMPDSAKMNALKIFEALLDEKIDVNDFIPVMRQMQFSLDMVAA* |
| ⦗Top⦘ |