NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157203_1000525

Scaffold Ga0157203_1000525


Overview

Basic Information
Taxon OID3300012663 Open in IMG/M
Scaffold IDGa0157203_1000525 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Indian River, Ontario, Canada - S50
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11587
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (18.18%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameWarsaw, Ontario
CoordinatesLat. (o)44.42735Long. (o)-78.1359Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029749Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0157203_100052511F029749N/AMTNYRIFNAKEYTAGQSGSLERAWGVMRGSAICSGSITLEGVVDNNLSGTIAQTNNHTTLKLEHLAVGEPVPCYVRSITVTSGNAYLLA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.