Basic Information | |
---|---|
Taxon OID | 3300012627 Open in IMG/M |
Scaffold ID | Ga0118283_106257 Open in IMG/M |
Source Dataset Name | Human skin bacterial and viral communities - University of Pennsylvania - MG100570 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Pennsylvania |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 694 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081456 | Metagenome | 114 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118283_1062572 | F081456 | AGGAG | MFEEPPIYYILISLIFLIVFGAISFATWLVWLTNGAFFFKLVITAIGFLFAAFTVILYTISAE* |
⦗Top⦘ |