Scaffold Ga0120980_100019

Overview

Basic Information

• Taxon OID: 3300012588
• Scaffold ID: Ga0120980_100019
• Source Dataset Name: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00623
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Weill Cornell Medical College
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 195561
• Total Scaffold Genes: 212
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 160 (75.47%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location

• Location Name: USA:New York City
• Coordinates
  • Lat. (^o): 40.81
  • Long. (^o): -73.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104510	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120980_10001919	F104510	GGA	VTEAKKLNWSMVGVIIALIMQAAALIFWGGGLNQRVSALEKVVAPLSDGTLARLDERTKAMKEQLDRIEREGR*