| Basic Information | |
|---|---|
| Taxon OID | 3300012533 Open in IMG/M |
| Scaffold ID | Ga0138256_11296065 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 537 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Kordia → unclassified Kordia → Kordia sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Austria: Klosterneuburg | |||||||
| Coordinates | Lat. (o) | 48.3 | Long. (o) | 16.2 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024534 | Metagenome / Metatranscriptome | 205 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138256_112960653 | F024534 | GGGGG | MKPSHLERVEALPDVFMFASLCQFKYVQTISEPNERNFVVGLAGGYEVFGAPQDYDKFMDKYLTWFELR* |
| ⦗Top⦘ |